PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00092506001
Common NameGSBRNA2T00092506001, LOC106379846
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family NF-YA
Protein Properties Length: 232aa    MW: 25672 Da    PI: 10.4301
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00092506001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA102.73.5e-32122178158
            CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                          +ep++VNaKQy++Il+RR++Rakle+++kl +ksrkpylheSRh hAl+R+RgsgGrF
  GSBRNA2T00092506001 122 NEPMFVNAKQYHAILRRRKHRAKLEAQNKL-IKSRKPYLHESRHLHALKRARGSGGRF 178
                          59****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005212.0E-36120181IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115237.155121181IPR001289Nuclear transcription factor Y subunit A
PfamPF020459.0E-27123178IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006164.7E-23124146IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860126146IPR018362CCAAT-binding factor, conserved site
PRINTSPR006164.7E-23155178IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 232 aa     Download sequence    Send to blast
MQVPTNSNIQ GSQSFSLTKN LMMPCKMKHS GLQLQDQDSS STQSTEESGG GYIVSPQGKA  60
IASYTKSTTT SSMVSHDSVF PPTYFNGFLA PEYASQSTVL PHVEMMGLVT SRVPLPHNYQ  120
ENEPMFVNAK QYHAILRRRK HRAKLEAQNK LIKSRKPYLH ESRHLHALKR ARGSGGRFLN  180
TKKLQESSKS LCSSLTTPSS SSDRDNMFQN APFRFSGYPS THHVSALMSG T*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A5e-21122183263NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.190483e-71seed
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC7876841e-124KC787684.1 Brassica napus transcription factor subunit NF-YA5B (NF-YA5B) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013675163.11e-172PREDICTED: nuclear transcription factor Y subunit A-5-like
SwissprotQ9SYH41e-111NFYA5_ARATH; Nuclear transcription factor Y subunit A-5
TrEMBLA0A078JTP51e-172A0A078JTP5_BRANA; BnaAnng31560D protein
STRINGBra014368.1-P1e-141(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM116331733
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G54160.12e-90nuclear factor Y, subunit A5
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]